SARS-CoV-2 M Protein, GFP/His-tagged
The M or matrix protein is the most abundant protein in the virus and is usually located at the inner layer of the virus envelope. The M protein defines the shape of the virus and contacts the N protein for additional stability.
Order Details
- 50µg – 780€
- more on request
Shipped next working day, depending on destination
Overview
Product Name | SARS-CoV-2 M Protein, GFP/His-tagged |
Catalog No. | P2020-020 |
RefSeq Links | UniProt P0DTC5 |
Synonyms | Membrane glycoprotein |
Sequence Information
Species | SARS-CoV-2; Wuhan seafood market pneumonia virus |
Tags | C-terminal |
Sequence with tags | MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRI NWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILR GHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIA LLVQ |
Product Information
Expression Host | human, HEK293-F (FreeStyle cells) |
Formulation | 20mM Tris, pH 7.5, 300mM NaCl, 0.05% DDM, 0.5% CHS |
Format | Liquid, stored and shipped at -80°C |
Purity | >85% as determined by SDS-PAGE |
Background Information
One of the most abundant proteins in the severe acute respiratory syndrome corona virus (SARS-CoV) is the matrix (M) protein. It is usually located at the inner layer of the viral envelope membrane and defines the shape of the virus together with the capsid. It establishes the contact between the nucleoprotein (N protein), the envelope protein (E protein) and the viral envelope for additional stability of the virus. Because of its high abundancy in the viral particle, it poses an attractive target for the development of vaccines and drugs against SARS-CoV-2. |
Further recombinant SARS-CoV-2 proteins

Reinhold Horlacher, PhD
Managing Director & CSO
We would be happy to provide you with your desired protein and to support you on your protein research project. If you have any questions or requests, our scientific experts will be happy to answer them shortly.
Get In Contact With Our Scientific Experts For Your Executable Quote Or Your Bulk Order