SARS-CoV-2 (COVID-19) S protein, His-Tag, stabilized trimer
Recombinant Spike protein of SARS-CoV-2 (COVID-19) from Wuhan pneumonia virus with C-terminal Strep- and His-Tag as a stabilized trimer and with deletion of the internal Furin-site. The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.
Order Details
- 100µg – 790€
- more on request – bulk and gram quantities available
Shipped next working day, depending on destination
Overview
| Product Name | SARS-CoV-2 (COVID-19) S protein, His-Tag, stabilized trimer |
| Catalog No. | P2020-025 |
| RefSeq Links | NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2 |
| Synonyms | SARS-CoV-2; coronavirus; SARS-CoV-2 spike protein; S glycoprotein; spike glycoprotein; 2019-nCoV; COVID-2019; COVID-19 |
| Product Information |  |
Sequence Information
| Species | SARS-CoV-2; Wuhan seafood market pneumonia virus |
| Tags | His-tag and Strep-tag, both C-terminal |
| Sequence without tags (AA 16-1211) | VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNG TKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQF CNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFK NIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSS SGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQT SNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFS TFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIA WNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSY GFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTES NKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDV NCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQ TQTNSPGASVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVD CTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDF GGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNG LTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLY ENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVL NDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQS KRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVS NGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFK NHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK |
Product Information
| Expression Host | human, HEK293 |
| Formulation | PBS, 5% (w/v) Trehalose; pH 7,4 |
| Format | Liquid, stored and shipped at -80°C |
| Purity | > 85% as determined by SDS-PAGE |
Background Information
| The SARS-CoV-2 spike is presented as a trimeric structure on the surface of the virus. It consists of three identical transmembrane proteins, called spike proteins, each containing two subunits: the S1 and the S2 subunit. The S1 is necessary for the recognition of the receptor on the surface of a susceptible cell. In addition, the S2 subunit is responsible for the fusion of the virus with the cell membrane of the host cell. Upon binding of the host receptor hACE2, the distal S1 domain is cleaved. This reveals the fusion machinery of the S2 subunit, which mediates the entry into the cell. Moreover, the Spike protein is heavily glycosylated by N-linked glycans that are important for the proper folding of the protein and the recognition by neutralizing antibodies. The engineered recombinant Spike protein contains specific amino acid substitutions to stabilize the prefusion conformation (2P). Furthermore, the furin cleavage site at the boundary between the S1/S2 subunits was deleted and an artificial trimerization domain was added to the C-terminal end of the monomer. Above all, the spike is a major immunogen and an interesting target for vaccine development as well as for serological assays. |
|
Size exclusion chromatography (SEC) of purified SARS-CoV-2 (COVID-19) S protein, His-Tag, stabilized trimer |
Activity of SARS-CoV-2 S1(RBD) and SARS-CoV-2 S protein (His-tag, trimer) |
 |
 |
| Activity of SARS-CoV-2 S1(RBD) and SARS-CoV-2 S protein (His-tag, trimer) were compared using Sandwich-ELISA based on coating with hACE2 (Cat# P2020-016, trenzyme) and detection with CR3022 anti-spike antibody (Ab01680-23.0, Absolute Antibody Ltd). CR3022 was detected using goat-anti-rabbit-HRP. SARS-CoV-2 S protein (His-tag, trimer) amount was increased to compensate for its size. |
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |
Further recombinant SARS-CoV-2 proteins
Learn more about our other recombinant SARS-CoV-2 proteins.
Reinhold Horlacher, PhD
Managing Director & CSO
We would be happy to provide you with your desired protein and to support you on your protein research project. If you have any questions or requests, our scientific experts will be happy to answer them shortly.
Get In Contact With Our Scientific Experts For Your Executable Quote Or Your Bulk Order