SARS-CoV-2 (COVID-19) Nucleocapsid protein, His-Tag
Recombinant SARS-CoV-2 (COVID-2019) Nucleoprotein (N-protein) from Wuhan pneumonia virus with C-terminal His-Tag.
Order Details
- 100µg – 420€
- more on request – bulk and gram quantities available
Shipped next working day, depending on destination
Overview
Sequence Information
Species | SARS-CoV-2; Wuhan seafood market pneumonia virus |
Tags | His-tag, C-terminal |
Sequence without tags (AA 1-419) | MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG KEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG LPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS QASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ QQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAY KTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQAS |
Product Information
Expression Host | E. coli |
Formulation | PBS, pH 7,4 |
Format | Liquid, stored and shipped at -80°C |
Purity | > 85% as determined by SDS-PAGE |
Background Information
Beneath its envelope membrane, the new coronavirus SARS-CoV-2 consists of a icosaedric nucleocapsid that contains its genectic information in form of positive sensed single-stranded RNA. The RNA is contained in a nucleoprotein complex, consisting of the SARS-CoV-2 (COVID-19) Nucleocapsid protein. This phophoprotein is necessary to keep the capsid in its helical symmetry and aids with packaging into the viral capsid by acting as a molecular RNA chaperone. Together with the matrix (M) protein, the N-protein is one of the most abundant proteins in the viral particle, it is important for viral replication and is also known for modulating cellular signalling. It is highly immunogenic and its sequence is very conserved, therefore it is an attractive target for diagnostic purposes. |
Further recombinant SARS-CoV-2 proteins
Learn more about our other recombinant SARS-CoV-2 proteins.

Reinhold Horlacher, PhD
Managing Director & CSO
We would be happy to provide you with your desired protein and to support you on your protein research project. If you have any questions or requests, our scientific experts will be happy to answer them shortly.
Get In Contact With Our Scientific Experts For Your Executable Quote Or Your Bulk Order