SARS-CoV-2 (COVID-19) Envelope Protein, GFP/His-tag
The E or envelope protein is embedded in the virus envelope towards the outside and contacts the S and M proteins to guarantee the stability of the virus particle.
Order Details
- 100µg – 350€
- more on request – bulk and gram quantities available
Shipped next working day, depending on destination
Overview
| Product Name | SARS-CoV-2 (COVID-19) Envelope Protein, GFP/His-tag |
| Catalog No. | P2020-032 |
| RefSeq Links | NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2 |
| Synonyms | SARS-CoV-2; coronavirus; SARS-CoV-2 enevelope protein; SARS-CoV-2 E protein; 2019-nCoV; COVID-2019; COVID-19 |
| Product Information |  |
Sequence Information
| Species | SARS-CoV-2; Wuhan seafood market pneumonia virus |
| Tags | His-tag, N-terminal and C-terminal GFP |
| Sequence without tags (AA 1-75) | MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV |
Product Information
| Expression Host | E.coli |
| Formulation | PBS, pH 7,4 |
| Format | Liquid, stored and shipped at -80°C |
| Purity | > 85% as determined by SDS-PAGE |
Background Information
| The SARS-CoV-2 virus belongs to the group of enveloped viruses, this means the virus buds from the cell membrane and borrows a part of the membrane for its envelope. The presence of this additional barrier is essential for the stability of the virus, it protects it against external and environmental influences like disinfecting agents, it also facilitates the entering into the host cell. Embedded in the host´s membrane around the virus are viral proteins like the spike protein trimer as well as an additional envelope (E) protein, whose function is not finally solved. It is suspected to establish the contact between the envelope membrane and the capsid. With only 75 AA it is rather small compared to the much larger spike protein complex (1273 AA). It is embedded in the virus envelope towards the outside and contacts the S and M proteins to guarantee the stability of the virus particle. |
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |
Further recombinant SARS-CoV-2 proteins
Learn more about our other recombinant SARS-CoV-2 proteins.
Reinhold Horlacher, PhD
Managing Director & CSO
We would be happy to provide you with your desired protein and to support you on your protein research project. If you have any questions or requests, our scientific experts will be happy to answer them shortly.
Get In Contact With Our Scientific Experts For Your Executable Quote Or Your Bulk Order