SARS-CoV-2 (COVID-19) Envelope Protein, GFP/His-tag

The E or envelope protein is embedded in the virus envelope towards the outside and contacts the S and M proteins to guarantee the stability of the virus particle.

Order Details

  • 100µg – 350€
  • more on request – bulk and gram quantities available

Shipped next working day, depending on destination

Overview

Product Name SARS-CoV-2 (COVID-19) Envelope Protein, GFP/His-tag
Catalog No. P2020-032
RefSeq Links NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2
Synonyms SARS-CoV-2; coronavirus; SARS-CoV-2 enevelope protein; SARS-CoV-2 E protein; 2019-nCoV; COVID-2019; COVID-19
Product Information

Sequence Information

Species SARS-CoV-2; Wuhan seafood market pneumonia virus
Tags His-tag, N-terminal and C-terminal GFP
Sequence without tags (AA 1-75) MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV

Product Information

Expression Host E.coli
Formulation PBS, pH 7,4
Format Liquid, stored and shipped at -80°C
Purity > 85% as determined by SDS-PAGE

Background Information

The SARS-CoV-2 virus belongs to the group of enveloped viruses, this means the virus buds from the cell membrane and borrows a part of the membrane for its envelope. The presence of this additional barrier is essential for the stability of the virus, it protects it against external and environmental influences like disinfecting agents, it also facilitates the entering into the host cell. Embedded in the host´s membrane around the virus are viral proteins like the spike protein trimer as well as an additional envelope (E) protein, whose function is not finally solved. It is suspected to establish the contact between the envelope membrane and the capsid. With only 75 AA it is rather small compared to the much larger spike protein complex (1273 AA). It is embedded in the virus envelope towards the outside and contacts the S and M proteins to guarantee the stability of the virus particle.

 

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE/Coll.Coomassie of SARS-CoV-2 E protein, GFP/His-tag Histogram of SARS-CoV-2 E protein, GFP/His-tag

 

Further recombinant SARS-CoV-2 proteins

Learn more about our other recombinant SARS-CoV-2 proteins.
Reinhold Horlacher, PhD

Reinhold Horlacher, PhD

Managing Director & CSO

We would be happy to provide you with your desired protein and to support you on your protein research project. If you have any questions or requests, our scientific experts will be happy to answer them shortly.

Get In Contact With Our Scientific Experts For Your Executable Quote Or Your Bulk Order

    Catalog Protein*

    Desired Quantity*









    By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.