Human ACE-2 (Angiotensin-Converting Enzyme 2) Protein, liquid formulation

The human Angiotensin-Converting Enzyme 2 (ACE-2) is a protein highly expressed at the surface of cells of the human lungs, arteries, kidney, heart and intestine and is shown to be the entry receptor for SARS-CoV-2 infection. The ACE-2 protein is one of the most important components for Coronavirus research to develop effective therapies for COVID-19.

Order Details

  • 100µg – 690€
  • more on request – bulk and gram quantities available

Shipped next working day, depending on destination

Overview

Product Name Human ACE2 Protein (ECD, processed), Tag-free, liquid formulation
Catalog No. P2020-016
RefSeq Links UniProt: Q9BYF1
Synonyms hACE2; ACEH; human angiotensin-converting enzyme 2; ACE-related carboxypeptidase; Angiotensin-converting enzyme homolog; Metalloprotease MPROT15

Sequence Information

Species Homo sapiens, human
Tags tag-free
Sequence without tags (AA 20-708) TIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST
LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP
QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED
YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP
IGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSV
GLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGH
IQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINF
LLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYC
DPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML
RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSI
KVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPR
ISFNFFVTAPKNVSDIIPRTEVEKAIRMSR

Product Information

Expression Host human, HEK293
Formulation 50 mM Tris, 250 mM NaCl, pH 8,0
Format Liquid, stored and shipped at -80°C
Purity > 80% as determined by SDS-PAGE

Background Information

 

The human Angiotensin-Converting Enzyme 2 (hACE-2) is a type I transmembrane metallocarboxypeptidase with homology to ACE, an regulator in the Renin-Angiotensin system (RAS) and long-known as a target for the treatment of hypertension.

hACE2 is expressed at the surface of cells of the human lungs, arteries, kidneys, heart and intestine – all tissues shown to harbor SARS-CoV. The function of ACE-2 is known as controlling blood pressure. This is accomplished by the hydrolysis of a small peptide hormone called Angiotensin II into the nonapeptide Angiotensin 1-9, which is thereafter converted into the heptapeptide angiotensin 1-7 by ACE and other endopeptidases. Angiotensin 1-7 acts in a vasoconstricting manner and is believed to be one of the main effectors in controlling the blood pressure and is therefore involved in pathophysiological processes like diabetes, hypertension and cardiac function in general. Recently it became known, that the new Coronavirus SARS-CoV-2 uses ACE-2 as the entry point into alveolar cells of the lungs, where it replicates and causes the Coronavirus disease (COVID-19).​

SARS-CoV-2 Spike S1 (RBD) recognizes hACE2 (ECD) with an affinity constant of 1 nM as verified by biolayer interferometry

Fluorescence chromatogram


Biolayer interferometry binding analysis graph
Analysis of released N-glycans by HILIC (example data) of hACE2.
Biolayer interferometry binding analysis (green lines) of hACE2 (ECD, processed), tag-free to immobilized SARS-CoV-2 Spike S1 (RBD), His-tag on Ni-NTA Dip and Read™ Biosensors. Grey lines correspond to a global fit of the data using a 1:1 binding model.
Device: Octet RED96e, ForteBio.
Analysis of released N-glycans by HILIC (example data). More and lot specific analytical data available on request (provided by our partner Biofidus AG).

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE/Coll.Coomassie of hACE2 Histogram (of marked lane in gel picture) of hACE2

Further recombinant SARS-CoV-2 proteins

Learn more about our other recombinant SARS-CoV-2 proteins.
Reinhold Horlacher, PhD

Reinhold Horlacher, PhD

Managing Director & CSO

We would be happy to provide you with your desired protein and to support you on your protein research project. If you have any questions or requests, our scientific experts will be happy to answer them shortly.

Get In Contact With Our Scientific Experts For Your Executable Quote Or Your Bulk Order

    Catalog Protein*

    Desired Quantity*









    By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.