hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated
The human Angiotensin-Converting Enzyme 2 (ACE-2) is a protein highly expressed at the surface of cells of the human lungs, arteries, kidney, heart and intestine and is shown to be the entry receptor for SARS-CoV-2 infection. The ACE-2 protein is one of the most important components for Coronavirus research to develop effective therapies for COVID-19.
Order Details
- 100µg – 590€
- more on request – bulk and gram quantities available
Shipped next working day, depending on destination
Overview
| Product Name | hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated |
| Catalog No. | P2020-037 |
| RefSeq Links | UniProt: Q9BYF1 |
| Synonyms | hACE2; ACEH; human angiotensin-converting enzyme 2; ACE-related carboxypeptidase; Angiotensin-converting enzyme homolog; Metalloprotease MPROT15 |
| Product Information |  |
Sequence Information
| Species | Homo sapiens, human |
| Tags | Avi/His-Tag, C-terminal, Avi-Tag not biotinylated |
| Sequence without tags (AA 20-708) | TIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP IGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSV GLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGH IQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINF LLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYC DPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSI KVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPR ISFNFFVTAPKNVSDIIPRTEVEKAIRMSSGGLNDIFEAQKIEWHEGSGHHHHHHHHG |
Product Information
| Expression Host | human, HEK293 |
| Formulation | PBS, pH 7,4 |
| Format | Liquid, stored and shipped at -80°C |
| Purity | > 90% as determined by SDS-PAGE |
Background Information
|
The human Angiotensin-Converting Enzyme 2 (hACE-2) is a type I transmembrane metallocarboxypeptidase with homology to ACE, an regulator in the Renin-Angiotensin system (RAS) and long-known as a target for the treatment of hypertension. hACE2 is expressed at the surface of cells of the human lungs, arteries, kidneys, heart and intestine – all tissues shown to harbor SARS-CoV. The function of ACE-2 is known as controlling blood pressure. This is accomplished by the hydrolysis of a small peptide hormone called Angiotensin II into the nonapeptide Angiotensin 1-9, which is thereafter converted into the heptapeptide angiotensin 1-7 by ACE and other endopeptidases. Angiotensin 1-7 acts in a vasoconstricting manner and is believed to be one of the main effectors in controlling the blood pressure and is therefore involved in pathophysiological processes like diabetes, hypertension and cardiac function in general. Recently it became known, that the new Coronavirus SARS-CoV-2 uses ACE-2 as the entry point into alveolar cells of the lungs, where it replicates and causes the Coronavirus disease (COVID-19). |
|
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
 |
 |
Further recombinant SARS-CoV-2 proteins
Reinhold Horlacher, PhD
Managing Director & CSO
We would be happy to provide you with your desired protein and to support you on your protein research project. If you have any questions or requests, our scientific experts will be happy to answer them shortly.
Get In Contact With Our Scientific Experts For Your Executable Quote Or Your Bulk Order