Biotinylated Human ACE2 Protein (ECD), Avi/His-Tag

The human Angiotensin-Converting Enzyme 2 (ACE-2) is a protein highly expressed at the surface of cells of the human lungs, arteries, kidney, heart and intestine and is shown to be the entry receptor for SARS-CoV-2 infection. The ACE-2 protein is one of the most important components for Coronavirus research to develop effective therapies for COVID-19.

Order Details

100µg – 890€
more on request – bulk and gram quantities available

Shipped next working day, depending on destination

Get a free quote

Overview

Product Name	Biotinylated Human ACE2 Protein (ECD), Avi/His-Tag
Catalog No.	P2020-017
RefSeq Links	UniProt: Q9BYF1
Synonyms	hACE2; ACEH; human angiotensin-converting enzyme 2; ACE-related carboxypeptidase; Angiotensin-converting enzyme homolog; Metalloprotease MPROT15; biotinylated hACE2
Product Information

Sequence Information

Species	Homo sapiens, human
Tags	Avi/His-tag, C-terminal
Sequence without tags (AA 20-707)	TIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP IGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSV GLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGH IQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINF LLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYC DPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSI KVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPR ISFNFFVTAPKNVSDIIPRTEVEKAIRMS

Product Information

Expression Host	human, HEK293
Formulation	PBS, pH 7,4
Format	Liquid, stored and shipped at -80°C
Purity	> 80% as determined by SDS-PAGE

Background Information

The human Angiotensin-Converting Enzyme 2 (hACE-2) is a type I transmembrane metallocarboxypeptidase with homology to ACE, an regulator in the Renin-Angiotensin system (RAS) and long-known as a target for the treatment of hypertension.
hACE2 is expressed at the surface of cells of the human lungs, arteries, kidneys, heart and intestine – all tissues shown to harbor SARS-CoV. The function of ACE-2 is known as controlling blood pressure. This is accomplished by the hydrolysis of a small peptide hormone called Angiotensin II into the nonapeptide Angiotensin 1-9, which is thereafter converted into the heptapeptide angiotensin 1-7 by ACE and other endopeptidases. Angiotensin 1-7 acts in a vasoconstricting manner and is believed to be one of the main effectors in controlling the blood pressure and is therefore involved in pathophysiological processes like diabetes, hypertension and cardiac function in general. Recently it became known, that the new Coronavirus SARS-CoV-2 uses ACE-2 as the entry point into alveolar cells of the lungs, where it replicates and causes the Coronavirus disease (COVID-19).

SDS-PAGE/Coll. Coomassie	Histogram of marked lane in gel picture

Further recombinant SARS-CoV-2 proteins

Learn more about our other recombinant SARS-CoV-2 proteins.

Get more information

Reinhold Horlacher, PhD

Managing Director & CSO

We would be happy to provide you with your desired protein and to support you on your protein research project. If you have any questions or requests, our scientific experts will be happy to answer them shortly.

Get In Contact With Our Scientific Experts For Your Executable Quote Or Your Bulk Order

Catalog Protein*

Desired Quantity*

By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.