B7-H3 Protein, Mouse

Recombinant protein containing the extracellular domain (ECD) of mouse CD276 with C-terminal His-Tag.

Get a free quote

Overview

Product Name B7-H3 Protein, Mouse
Catalog No. P2020-003
RefSeq Links Uniprot# Q8VE98
Synonyms B7 homolog 3; B7-H3 Protein, Mouse; B7H3 Protein, Mouse; B7RP-2 Protein; CD276

Sequence Information

Species Mus musculus; mouse
Tags His-tag, C-terminal
Sequence without tags VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNAS
LRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQG
VPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFP

Product Information

Expression Host human, HEK293
Formulation PBS, pH 7,4
Format  Liquid, stored and shipped at -80°C
Purity > 95% as determined by SDS-PAGE

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

 

Further off-the-shelf recombinant proteins

Learn more about our other off-the-shelf recombinant proteins in our continuously growing catalog.

Get more information
Reinhold Horlacher, PhD

Reinhold Horlacher, PhD

Managing Director & CSO

We would be happy to provide you with support on your protein research project. Let us know your questions and requests, our scientific experts will reply shortly.

Get In Contact With Our Scientific Experts

    Catalog Protein*

    Desired Quantity*






    By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.