B7-H3 Protein, Mouse
Recombinant protein containing the extracellular domain (ECD) of mouse CD276 with C-terminal His-Tag.
Overview
Product Name | B7-H3 Protein, Mouse |
Catalog No. | P2020-003 |
RefSeq Links | Uniprot# Q8VE98 |
Synonyms | B7 homolog 3; B7-H3 Protein, Mouse; B7H3 Protein, Mouse; B7RP-2 Protein; CD276 |
Sequence Information
Species | Mus musculus; mouse |
Tags | His-tag, C-terminal |
Sequence without tags | VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNAS LRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQG VPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFP |
Product Information
Expression Host | human, HEK293 |
Formulation | PBS, pH 7,4 |
Format | Liquid, stored and shipped at -80°C |
Purity | > 95% as determined by SDS-PAGE |
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
![]() |
![]() |
Further off-the-shelf recombinant proteins
Learn more about our other off-the-shelf recombinant proteins in our continuously growing catalog.

Reinhold Horlacher, PhD
Managing Director & CSO
We would be happy to provide you with support on your protein research project. Let us know your questions and requests, our scientific experts will reply shortly.
Get In Contact With Our Scientific Experts